PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 906588
Common NameARALYDRAFT_906588
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 1656aa    MW: 181250 Da    PI: 6.9117
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
906588genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.7e-11873914346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT eE e+++++ +++G++ +k+I++++   +t  +c+++++k
           906588 873 PWTSEEKEIFLNLLALHGKD-FKKISSYLT-QKTTADCIDYYYK 914
                      8*****************99.********9.9**********98 PP

2Myb_DNA-binding28.92.6e-0910881129447
                       S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding    4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47  
                       WT +E   +++++ ++G++ +++I+r++g +R++ qck ++ k+
           906588 1088 WTDDERSAFIQGFSLFGKN-FASISRYVG-TRSPDQCKVFFSKV 1129
                       *****************99.*********.********998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.94E-14856917IPR009057Homeodomain-like
PROSITE profilePS5129314.117869920IPR017884SANT domain
SMARTSM007171.1E-9870918IPR001005SANT/Myb domain
PfamPF002493.0E-9872914IPR001005SANT/Myb domain
CDDcd001675.48E-8873915No hitNo description
Gene3DG3DSA:1.10.10.603.7E-7873915IPR009057Homeodomain-like
PROSITE profilePS5129313.03910831134IPR017884SANT domain
SMARTSM007174.0E-810841132IPR001005SANT/Myb domain
SuperFamilySSF466891.01E-910871134IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-510871128IPR009057Homeodomain-like
CDDcd001675.06E-710881129No hitNo description
PfamPF002491.4E-710881128IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1656 aa     Download sequence    Send to blast
MPQDHASWDR KELLRQRKHD RPEQSSFDSP PFRWRDSPST PSSHHVPREF SSRWGSADFR  60
RPSCHGKQGG RHQFAEETSH GYTSSRSSAR TFDNDYYRPS ASRGDWRYTR NCRDDRISVS  120
QKEWKCNTWE MSNGSSRSFE RPFGIRNGRR SVDERPLHAS DTHTTVVNSL DPANSTHQPD  180
NEICTPVRSL KFKNEQKFSD QRLSLPSDPH SDCVSLFERP SLENNYGNKV CSPAKQCNDL  240
MYGRRLANDN SLDPPVLNAE LAGTWEQLHP KDPQDNNGLH GISDLDGATK CAKEASLGAI  300
GKLPLWNSSG SFASQSSGFS HSSSLKSLGA VDSSDRKIEV LPKIVTVTQS SSGDATACAT  360
TTHLSEEMSS RKKQRLGWGE GLAKYEKKKV DVNTNEDGTP LLENGSEELH SLNKNIADKS  420
PTAATLPDYG SPTTPSSVAC SSSPGFADKS SPKAAIAASD VSNTCRSPSP MSSIHLERFP  480
INIEELDNIS MERFGCLLNE LLGTDDPGTG DSSSVQLTSM NRLLAWKGEI LKAVEMTESE  540
IDLLENKHRT LKLEGGRHCR VVGPSSYFCD GDANVPKEQA SCILDPKAAA SSVAETLVRA  600
PVLLAGLAKV PVDVFEDNPG VVKSLSQSFA TVESNEDILP IPSMKAAASS KEINTPAFVN  660
QETIEVSSAD DSMASNDDLL CAKLLSANKK YACESSGVFN ELLPKDFSSS DNSRYPGICQ  720
TQFDSHVKEK IADRVDLLRA REKILLLQFK AFQLSWKKDL DQLALTKYQP KSSKKTELYP  780
NAKNGGYLKL PQPVRLRFSS SAPRRDSVVP TTELVSYMEK LLPGTHLKPY RDIMKMPAMI  840
LDEKERVMSR FISSNGLIED PCDVEKERTM INPWTSEEKE IFLNLLALHG KDFKKISSYL  900
TQKTTADCID YYYKNHKSDC FGKIKKQRAY GKEGKHTYML APRKKWKREM GAASLDILGD  960
VSIIAANAGK VASTRPISSK RITLRGCSSA NSLQHDGNNS EGCSYSFDFP RKRTAGADVL  1020
AVGSLSSEQI NSCLRTSVSS RERCMDHLKF NHVVKKPRIS HTLHNENSNE EDDSCSEESC  1080
GETGPIHWTD DERSAFIQGF SLFGKNFASI SRYVGTRSPD QCKVFFSKVR KCLGLESIQF  1140
GSGNVSTSVS VDNGNEGGGS DLEDPCPMES NSGICNNGVC AKMGMNSPTS PFNMNQDGAN  1200
HSGSANVKAD LSRSEQENEQ TYLCLKDDNN LVNNAYINGG FPSLVSESCR DLVDINTVES  1260
QSQAAGKSKS NDLLSMEIDE GVLTSVVVSS EPLYCGLSVL SNVIVETPTE ISGKGSGDQG  1320
AAMPKLSSKN QDGVMQAANR TRNSGLEPES APSGFRYPEC LHHVPIEVCT ENPIGVSVPR  1380
GNPNCHTESE SGNSLVGQVD KTHDLGWPKN NLELNRKLRV LGHVNPDEQN GQLNATNAAS  1440
CQIPQRSVTQ DLSRISRSKS DLIVKTQRTG EGFSLNKCTS SAPKPLAVSH KEGRSGHSRS  1500
HSFSLSDTER LDKNGDVKLF GTVLTADENG IKQKHNSCGI VRSSSTLSRD HDTRHHYINQ  1560
QHLQNVPITS YGFWDGNRIQ TGLTSLPESA KLLASCPEAF STHLKQQIGN SKEILLDVNG  1620
GILSFGKHNE DRAESSSAKD EGNIGGVNGV AEAAT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D3e-15831921493NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C3e-15831921493NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1329720.0AL132972.1 Arabidopsis thaliana DNA chromosome 3, BAC clone T25B15.
GenBankCP0026860.0CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002876132.10.0myb family transcription factor
TrEMBLD7LU400.0D7LU40_ARALL; Myb family transcription factor
STRINGscaffold_502292.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.10.0MYB family protein